CLIC4 Rabbit Polyclonal Antibody

CAT#: TA338569

Rabbit Polyclonal Anti-CLIC4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4381.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CLIC4 antibody: synthetic peptide directed towards the N terminal of human CLIC4. Synthetic peptide located within the following region: LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 28 kDa
Gene Name chloride intracellular channel 4
Background Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008]
Synonyms CLIC4L; H1; huH1; MTCLIC; p64H1
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Dog: 92%; Zebrafish: 82%
Reference Data
Protein Families Druggable Genome, Ion Channels: Other
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...