P2X6 (P2RX6) Rabbit Polyclonal Antibody
CAT#: TA338554
Rabbit Polyclonal Anti-P2RXL1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 4840.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-P2RXL1 antibody: synthetic peptide directed towards the N terminal of human P2RXL1. Synthetic peptide located within the following region: ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 47 kDa |
| Gene Name | purinergic receptor P2X 6 |
| Database Link | |
| Background | The protein encoded by this gene belongs to the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. This gene is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 22, has been identified. [provided by RefSeq, Apr 2009] |
| Synonyms | P2RXL1; P2X6; P2XM |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93% |
| Reference Data | |
| Protein Families | Druggable Genome, Ion Channels: ATP Receptors, Transmembrane |
| Protein Pathways | Calcium signaling pathway, Neuroactive ligand-receptor interaction |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
