KCND1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Kcnd1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	potassium voltage-gated channel subfamily D member 1
Database Link	NP_004970 Entrez Gene 16506 Mouse UniProt ID Q9NSA2
Background	Kcnd1 is a pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. It may contribute to I(To) current in the heart and I(Sa) current in neurons. Channel properties are modulated by subunit assembly.
Synonyms	KV4.1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Potassium, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.