KCNQ3 Rabbit Polyclonal Antibody
CAT#: TA338539
Rabbit Polyclonal Anti-Kcnq3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse, Hamster |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 97 kDa |
Gene Name | potassium voltage-gated channel subfamily Q member 3 |
Database Link | |
Background | Probably important in the regulation of neuronal excitability. Associates with KCNQ2 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs. |
Synonyms | BFNC2; EBN2; KV7.3 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Pig: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |