SCUBE2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SCUBE2 antibody: synthetic peptide directed towards the C terminal of human SCUBE2. Synthetic peptide located within the following region: KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	110 kDa
Gene Name	signal peptide, CUB domain and EGF like domain containing 2
Database Link	NP_066025 Entrez Gene 57758 Human UniProt ID Q9NQ36
Background	SCUBE2 contains 1 CUB domain and 9 EGF-like domains. The function of the SCUBE2 protein remains unknown.
Synonyms	CEGB1; CEGF1; CEGP1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Mouse: 86%; Zebrafish: 83%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.