IGSF9 Rabbit Polyclonal Antibody
CAT#: TA338439
Rabbit Polyclonal Anti-IGSF9 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-IGSF9 antibody: synthetic peptide directed towards the N terminal of human IGSF9. Synthetic peptide located within the following region: SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 125 kDa |
Gene Name | immunoglobulin superfamily member 9 |
Database Link | |
Background | IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type-III domains and 5 Ig-like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation. |
Synonyms | FP18798; IGSF9A; Nrt1 |
Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |