ADCY2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ADCY2 antibody: synthetic peptide directed towards the middle region of human ADCY2. Synthetic peptide located within the following region: FLSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	123 kDa
Gene Name	adenylate cyclase 2 (brain)
Database Link	NP_065433 Entrez Gene 108 Human UniProt ID Q08462
Background	This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex.
Synonyms	AC2; HBAC2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 79%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Calcium signaling pathway, Chemokine signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Melanogenesis, Oocyte meiosis, Progesterone-mediated oocyte maturation, Purine metabolism, Vascular smooth muscle contraction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.