DOLPP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DOLPP1 antibody: synthetic peptide directed towards the N terminal of human DOLPP1. Synthetic peptide located within the following region: AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	dolichyldiphosphatase 1
Database Link	NP_065171 Entrez Gene 57171 Human UniProt ID Q86YN1
Background	DOLPP1 is a multi-pass membrane proteinBy similarity. It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate.
Synonyms	LSFR2
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	N-Glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.