Entpd7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Entpd7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Entpd7. Synthetic peptide located within the following region: GMAWPVLAQRFKNGLFSSHADEHRLKYQCFKSAWMYEVLHEGFHFPYDYP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	ectonucleoside triphosphate diphosphohydrolase 7
Database Link	NP_444333 Entrez Gene 93685 Mouse UniProt ID Q3TCT4
Background	Entpd7 preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP .
Synonyms	DKFZp667O124; FLJ30978; FLJ31830; FLJ41522; FLJ95364; LALP1; MGC141913; RP11-483F11.1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.