SEMA4B Rabbit Polyclonal Antibody
CAT#: TA338408
Rabbit Polyclonal Anti-SEMA4B Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SEMA4B antibody: synthetic peptide directed towards the N terminal of human SEMA4B. Synthetic peptide located within the following region: KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 93 kDa |
Gene Name | semaphorin 4B |
Database Link | |
Background | SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. |
Synonyms | SEMAC; SemC |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 86% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Axon guidance |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |