SPRN Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SPRN antibody is: synthetic peptide directed towards the N-terminal region of Human SPRN. Synthetic peptide located within the following region: LLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPG |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 10 kDa |
| Gene Name | shadow of prion protein homolog (zebrafish) |
| Database Link | |
| Background | SPRN is a prion-like protein that has PrP(C)-like neuroprotective activity. SPRN may act as a modulator for the biological actions of normal and abnormal PrP. |
| Synonyms | bA108K14.1; SHADOO; SHO |
| Note | Immunogen Sequence Homology: Goat: 100%; Human: 100%; Dog: 93%; Sheep: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
