GRIP2 Rabbit Polyclonal Antibody
CAT#: TA338324
Rabbit Polyclonal Anti-GRIP2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GRIP2 antibody is: synthetic peptide directed towards the C-terminal region of Human GRIP2. Synthetic peptide located within the following region: IRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVSYTVELKR |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 123 kDa |
Gene Name | glutamate receptor interacting protein 2 |
Database Link | |
Background | GRIP2 may play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons. |
Synonyms | glutamate receptor interacting protein 2 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |