Syncollin (SYCN) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SYCN antibody is: synthetic peptide directed towards the N-terminal region of Human SYCN. Synthetic peptide located within the following region: MSPLRPLLLALALASVPCAQGACPASADLKHSDGTRTCAKLYDKSDPYYE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	15 kDa
Gene Name	syncollin
Database Link	NP_001073937 Entrez Gene 342898 Human UniProt ID Q0VAF6
Background	SYCN functions in exocytosis in pancreatic acinar cells regulating the fusion of zymogen granules with each other. SYCN may have a pore-forming activity on membranes and regulate exocytosis in other exocrine tissues.
Synonyms	INSSA1; SYL
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 86%; Pig: 86%; Rat: 79%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.