GRID2IP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GRID2IP antibody is: synthetic peptide directed towards the middle region of Human GRID2IP. Synthetic peptide located within the following region: CFLGYTAMTAEPEPELDLESEPTPEPQPRSSLRASSMCRRSLRSQGLEAG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	132 kDa
Gene Name	Grid2 interacting protein
Database Link	NP_001138590 Entrez Gene 392862 Human UniProt ID A4D2P6
Background	Glutamate receptor delta-2 is predominantly expressed at parallel fiber-Purkinje cell postsynapses and plays crucial roles in synaptogenesis and synaptic plasticity. GRID2IP1 interacts with GRID2 and may control GRID2 signaling in Purkinje cells.
Synonyms	DELPHILIN
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Horse: 91%; Rat: 87%; Mouse: 87%; Rabbit: 86%; Bovine: 79%; Dog: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.