PLXNB3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PLXNB3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLXNB3. Synthetic peptide located within the following region: DYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVRQGLTQLSNLLNSKL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	171 kDa
Gene Name	plexin B3
Database Link	NP_001156729 Entrez Gene 5365 Human UniProt ID Q9ULL4
Background	The protein encoded by this gene is a member of the plexin family. It functions as a receptor for semaphorin 5A, and plays a role in axon guidance, invasive growth and cell migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Synonyms	PLEXB3; PLEXR; PLXN6
Note	Immunogen Sequence Homology: Human: 100%; Pig: 83%; Guinea pig: 83%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Axon guidance

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.