RAGEF2 (RAPGEF6) Rabbit Polyclonal Antibody
CAT#: TA338292
Rabbit Polyclonal Anti-RAPGEF6 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAPGEF6 antibody is: synthetic peptide directed towards the N-terminal region of Human RAPGEF6. Synthetic peptide located within the following region: GSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVENAKDNEDSILQREIPA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 157 kDa |
Gene Name | Rap guanine nucleotide exchange factor 6 |
Database Link | |
Background | RAPGEF6 is a guanine nucleotide exchange factor (GEF) for Rap1A, Rap2A and M-Ras GTPases. RAPGEF6 does not interact with cAMP. |
Synonyms | KIA001LB; PDZ-GEF2; PDZGEF2; RA-GEF-2; RAGEF2 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |