DPAGT1 Rabbit Polyclonal Antibody
CAT#: TA338275
Rabbit Polyclonal Anti-DPAGT1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-DPAGT1 antibody is: synthetic peptide directed towards the C-terminal region of Human DPAGT1. Synthetic peptide located within the following region: TKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLG |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 46 kDa |
| Gene Name | dolichyl-phosphate N-acetylglucosaminephosphotransferase 1 |
| Database Link | |
| Background | The protein encoded by this gene is an enzyme that catalyzes the first step in the dolichol-linked oligosaccharide pathway for glycoprotein biosynthesis. This enzyme belongs to the glycosyltransferase family 4. This protein is an integral membrane protein of the endoplasmic reticulum. The congenital disorder of glycosylation type Ij is caused by mutation in the gene encoding this enzyme. |
| Synonyms | ALG7; CDG-Ij; CDG1J; CMSTA2; D11S366; DGPT; DPAGT; DPAGT2; G1PT; GPT; UAGT; UGAT |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rat: 86%; Pig: 79%; Horse: 79%; Mouse: 79%; Guinea pig: 79%; Rabbit: 77% |
| Reference Data | |
| Protein Families | Transmembrane |
| Protein Pathways | Metabolic pathways, N-Glycan biosynthesis |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
