UQCRC2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	ubiquinol-cytochrome c reductase core protein II
Database Link	NP_003357 Entrez Gene 7385 Human UniProt ID P22695
Background	This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex.
Synonyms	MC3DN5; QCR2; UQCR2
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 93%; Rat: 86%; Goat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Protease
Protein Pathways	Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.