Semaphorin 7a (SEMA7A) Rabbit Polyclonal Antibody

CAT#: TA338228

Rabbit Polyclonal Anti-SEMA7A Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SEMA7A antibody is: synthetic peptide directed towards the C-terminal region of Human SEMA7A. Synthetic peptide located within the following region: SIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 68 kDa
Gene Name semaphorin 7A (John Milton Hagen blood group)
Background The protein encoded by this gene binds to cell surfaces through a glycosylphosphatidylinositol (GPI) linkage. The encoded glycoprotein is found on activated lymphocytes and erythrocytes. This protein may be involved in immunomodulatory and neuronal processes. Defects in this gene can result in loss of bone mineral density (BMD). Three transcript variants encoding different isoforms have been found for this gene.
Synonyms CD108; CDw108; H-SEMA-K1; H-Sema-L; JMH; SEMAK1; SEMAL
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 79%
Reference Data
Protein Pathways Axon guidance
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...