SLC17A1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC17A1 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC17A1. Synthetic peptide located within the following region: VHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNW
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	solute carrier family 17 member 1
Database Link	NP_005065 Entrez Gene 6568 Human UniProt ID Q14916
Background	The function of this protein remains unknown.
Synonyms	NAPI-1; NPT-1; NPT1
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 85%; Dog: 83%; Pig: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.