ZNF258 (ZMYM6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF258 antibody: synthetic peptide directed towards the middle region of human ZNF258. Synthetic peptide located within the following region: TPVITSVMSLAKIPATLSTGNTNSVLKGAVTKEAAKIIQDESTQEDAMKF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	zinc finger MYM-type containing 6
Database Link	NP_009098 Entrez Gene 9204 Human UniProt ID O95789
Background	ZNF258 is part of a novel, putative, zinc-binding motif (MYM) family which encodes proteins that maintain the repeats of the MYM motif.
Synonyms	Buster2; MYM; ZBED7; ZNF198L4; ZNF258
Note	Immunogen Sequence Homology: Human: 100%; Dog: 91%; Rabbit: 85%; Horse: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.