CTNNA3 Rabbit Polyclonal Antibody
CAT#: TA338101
Rabbit Polyclonal Anti-CTNNA3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CTNNA3 antibody is: synthetic peptide directed towards the N-terminal region of Human CTNNA3. Synthetic peptide located within the following region: PLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLLDKGEKIAQ |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | catenin alpha 3 |
Database Link | |
Background | CTNNA3 may be involved in formation of stretch-resistant cell-cell adhesion complexes. |
Synonyms | ARVD13; VR22 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Pig: 85%; Zebrafish: 83% |
Reference Data | |
Protein Pathways | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Endometrial cancer, Leukocyte transendothelial migration, Pathways in cancer, Tight junction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |