MAST1 Rabbit Polyclonal Antibody
CAT#: TA338071
Rabbit Polyclonal Anti-MAST1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MAST1 antibody is: synthetic peptide directed towards the N-terminal region of Human MAST1. Synthetic peptide located within the following region: TRDPFPDVVHLEEQDSGGSNTPEQDDLSEGRSSKAKKPPGENDFDTIKLI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 171 kDa |
Gene Name | microtubule associated serine/threonine kinase 1 |
Database Link | |
Background | MAST1 appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins. |
Synonyms | SAST; SAST170 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rat: 88%; Mouse: 88%; Horse: 81%; Rabbit: 81%; Guinea pig: 75% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |