MON2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MON2 antibody is: synthetic peptide directed towards the C-terminal region of Human MON2. Synthetic peptide located within the following region: SVAFHCLLDLVRGITSMIEGELGELETECQTTTEEGSSPTQSTEQQDLQS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	MON2 homolog, regulator of endosome-to-Golgi trafficking
Database Link	NP_055841 Entrez Gene 23041 Human UniProt ID Q7Z3U7
Background	The function of this protein remains unknown.
Synonyms	KIAA1040; MGC35493
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 86%; Bovine: 86%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.