NDRG3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NDRG3 antibody is: synthetic peptide directed towards the C-terminal region of Human NDRG3. Synthetic peptide located within the following region: RLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTME
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	NDRG family member 3
Database Link	NP_071922 Entrez Gene 57446 Human UniProt ID Q9UGV2
Background	The function of this protein remains unknown.
Synonyms	FLJ13556
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Bovine: 92%; Horse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.