MMP28 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MMP28 antibody is: synthetic peptide directed towards the N-terminal region of Human MMP28. Synthetic peptide located within the following region: LDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	matrix metallopeptidase 28
Database Link	NP_077278 Entrez Gene 79148 Human UniProt ID Q9H239
Background	The function of this protein remains unknown.
Synonyms	EPILYSIN; MM28; MMP-25; MMP-28; MMP25
Note	Immunogen Sequence Homology: Human: 100%; Dog: 92%
Reference Data
Protein Families	Druggable Genome, Protease, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.