CEP135 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CEP135 antibody is: synthetic peptide directed towards the N-terminal region of Human CEP135. Synthetic peptide located within the following region: REHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	133 kDa
Gene Name	centrosomal protein 135
Database Link	NP_079285 Entrez Gene 9662 Human UniProt ID Q66GS9
Background	CEP135 is a centrosomal protein involved in centriole biogenesis. CEP135 acts as a scaffolding protein during early centriole biogenesis. CEP135 is also required for centriole-centriole cohesion during interphase by acting as a platform protein for CEP250 at the centriole.
Synonyms	CEP4; KIAA0635; MCPH8
Note	Immunogen Sequence Homology: Human: 100%; Horse: 85%; Rabbit: 85%; Dog: 77%; Pig: 77%; Bovine: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.