TBXAS1 Rabbit Polyclonal Antibody
CAT#: TA337958
Rabbit Polyclonal Anti-TBXAS1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: GYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 52 kDa |
Gene Name | thromboxane A synthase 1 |
Database Link | |
Background | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Synonyms | BDPLT14; CYP5; CYP5A1; GHOSAL; THAS; TS; TXAS; TXS |
Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%; Guinea pig: 93%; Rat: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 79% |
Reference Data | |
Protein Families | Druggable Genome, P450 |
Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |