RNF36 (TRIM69) Rabbit Polyclonal Antibody
CAT#: TA337935
Rabbit Polyclonal Anti-RNF36 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RNF36 antibody: synthetic peptide directed towards the N terminal of human RNF36. Synthetic peptide located within the following region: SIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | tripartite motif containing 69 |
Database Link | |
Background | RNF36 is specifically expressed in germ cells at round spermatid stages during spermatogenesis. The protein encoded by this gene contains an N-terminal RING finger motif, a B-box, and a C-terminal B-30.2-like domain. When overexpressed in COS-7 and HEK-293 cells, this protein was shown to induce cell apoptosis. |
Synonyms | HSD-34; HSD34; RNF36; Trif |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 85%; Mouse: 85%; Horse: 79%; Bovine: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |