YTHDC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-YTHDC1 antibody is: synthetic peptide directed towards the N-terminal region of Human YTHDC1. Synthetic peptide located within the following region: GKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	83 kDa
Gene Name	YTH domain containing 1
Database Link	NP_588611 Entrez Gene 91746 Human UniProt ID Q96MU7
Background	YTHDC1 may be part of a signal transduction pathway that influences splice site selection.
Synonyms	YT521; YT521-B
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92%; Yeast: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.