ACMSD Rabbit Polyclonal Antibody

CAT#: TA337920

Rabbit Polyclonal Anti-ACMSD Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of aminocarboxymuconate semialdehyde decarboxylase (ACMSD)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human aminocarboxymuconate semialdehyde decarboxylase (ACMSD), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human aminocarboxymuconate semialdehyde decarboxylase (ACMSD), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ACMSD antibody: synthetic peptide directed towards the middle region of human ACMSD. Synthetic peptide located within the following region: NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 38 kDa
Gene Name aminocarboxymuconate semialdehyde decarboxylase
Background The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon-semialdehyde (ACMS). ACMSD (ACMS decarboxylase; EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS. [supplied by OMIM, Oct 2004]. ##Evidence-Data-START## Transcript exon combination :: BC107420.1, AB071418.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025084 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; aminocarboxymuconate semialdehyde decarboxylase; OTTHUMP00000162500
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%; Guinea pig: 85%
Reference Data
Protein Families Transmembrane
Protein Pathways Metabolic pathways, Tryptophan metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...