STARD6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-STARD6 antibody is: synthetic peptide directed towards the N-terminal region of Human STARD6. Synthetic peptide located within the following region: NRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	StAR related lipid transfer domain containing 6
Database Link	NP_631910 Entrez Gene 147323 Human UniProt ID P59095
Background	Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins and by liver X receptors. Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein. STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD6.
Synonyms	OTTHUMP00000163555; StAR-related lipid transfer (START) domain containing 6; START domain containing 6; START domain containing protein 6
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 92%; Bovine: 92%; Rabbit: 92%; Pig: 83%; Mouse: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.