MUC15 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MUC15 antibody: synthetic peptide directed towards the middle region of human MUC15. Synthetic peptide located within the following region: KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	mucin 15, cell surface associated
Database Link	NP_663625 Entrez Gene 143662 Human UniProt ID Q8N387
Background	May play a role in the cell adhesion to the extracellular matrix.
Synonyms	MUC-15; PAS3; PASIII
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Bovine: 90%; Mouse: 85%; Pig: 79%; Horse: 79%; Guinea pig: 79%; Dog: 77%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.