Glypican 2 (GPC2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GPC2 antibody is: synthetic peptide directed towards the C-terminal region of Human GPC2. Synthetic peptide located within the following region: GRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	glypican 2
Database Link	NP_689955 Entrez Gene 221914 Human UniProt ID Q8N158
Background	GPC2 is a cell surface proteoglycan that bears heparan sulfate. GPC2 may fulfill a function related to the motile behaviors of developing neurons.
Synonyms	DKFZp547M109; FLJ38962
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Zebrafish: 92%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.