ASPRV1 Rabbit Polyclonal Antibody
CAT#: TA337869
Rabbit Polyclonal Anti-ASPRV1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ASPRV1antibody: synthetic peptide directed towards the middle region of human SASP. Synthetic peptide located within the following region: RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 37 kDa |
Gene Name | aspartic peptidase, retroviral-like 1 |
Database Link | |
Background | The specific function of ASPRV1is not yet known. |
Synonyms | MUNO; SASP; SASPase; Taps |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rat: 93%; Pig: 92%; Guinea pig: 92% |
Reference Data | |
Protein Families | Druggable Genome, Protease |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |