ODF4 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ODF4 antibody: synthetic peptide directed towards the N terminal of human ODF4. Synthetic peptide located within the following region: MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 29 kDa |
| Gene Name | outer dense fiber of sperm tails 4 |
| Database Link | |
| Background | ODF4 is the component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton. This gene encodes a protein that is localized in the outer dense fibers of the tails of mature sperm. This protein is thought to have some important role in the sperm tail. Sequence Note: The RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. |
| Synonyms | CT134; CT136; OPPO1 |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
