UBE2Q2 Rabbit Polyclonal Antibody
CAT#: TA337794
Rabbit Polyclonal Anti-UBE2Q2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UBE2Q2 antibody is: synthetic peptide directed towards the middle region of Human UBE2Q2. Synthetic peptide located within the following region: EDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 43 kDa |
Gene Name | ubiquitin conjugating enzyme E2 Q2 |
Database Link | |
Background | UBE2Q2 accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro UBE2Q2 catalyzes 'Lys-48'-linked polyubiquitination. |
Synonyms | DKFZp762C143 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 92% |
Reference Data | |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |