C19orf21 (MISP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MISP antibody: synthetic peptide directed towards the C terminal of human MISP. Synthetic peptide located within the following region: RRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	75 kDa
Gene Name	mitotic spindle positioning
Database Link	NP_775752 Entrez Gene 126353 Human UniProt ID Q8IVT2
Background	The exact function of MISP remains unknown.
Synonyms	C19orf21; MISP1
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.