C15ORF26 (CFAP161) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C15orf26 antibody is: synthetic peptide directed towards the middle region of Human C15orf26. Synthetic peptide located within the following region: LCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	cilia and flagella associated protein 161
Database Link	NP_775799 Entrez Gene 161502 Human UniProt ID Q6P656
Background	The exact function of C15orf26 remains unknown.
Synonyms	FLJ38615
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.