Gpr4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Gpr4 antibody is: synthetic peptide directed towards the middle region of Mouse Gpr4. Synthetic peptide located within the following region: LCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFAPYHALLLSRS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	G protein-coupled receptor 4
Database Link	NP_783599 Entrez Gene 319197 Mouse UniProt ID Q8BUD0
Background	Gpr4 is a proton-sensing receptor coupled to several G-proteins, including G(s), G(13) and G(q)/G(11) proteins, leading to cAMP production.
Synonyms	GPR4
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Bovine: 93%; Zebrafish: 93%; Mouse: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.