Alpha Taxilin (TXLNA) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TXLNA antibody is: synthetic peptide directed towards the N-terminal region of Human TXLNA. Synthetic peptide located within the following region: APRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	taxilin alpha
Database Link	NP_787048 Entrez Gene 200081 Human UniProt ID P40222
Background	TXLNA may be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells.
Synonyms	IL14; TXLN
Note	Immunogen Sequence Homology: Human: 100%; Dog: 85%; Horse: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.