GPR86 (P2RY13) Rabbit Polyclonal Antibody
CAT#: TA337752
Rabbit Polyclonal Anti-P2RY13 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-P2RY13 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY13. Synthetic peptide located within the following region: YTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | purinergic receptor P2Y13 |
Database Link | |
Background | The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is activated by ADP. |
Synonyms | FKSG77; GPCR1; GPR86; GPR94; P2Y13; SP174 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Bovine: 93%; Pig: 92%; Guinea pig: 92%; Dog: 86%; Mouse: 86%; Rabbit: 79%; Horse: 77% |
Reference Data | |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |