TAS1R1 Rabbit Polyclonal Antibody

CAT#: TA337751

Rabbit Polyclonal Anti-TAS1R1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 3
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R1. Synthetic peptide located within the following region: NINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGT
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name taste 1 receptor member 1
Background The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms GM148; GPR70; T1R1; TR1
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Rat: 91%; Dog: 86%; Bovine: 85%; Mouse: 83%; Rabbit: 83%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Taste transduction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...