SPG3A (ATL1) Rabbit Polyclonal Antibody
CAT#: TA337733
Rabbit Polyclonal Anti-SPG3A Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SPG3A antibody is: synthetic peptide directed towards the C-terminal region of Human SPG3A. Synthetic peptide located within the following region: DQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 52 kDa |
Gene Name | atlastin GTPase 1 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | AD-FSP; atlastin1; FSP1; GBP3; HSN1D; SPG3; SPG3A |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 92%; Rabbit: 92%; Mouse: 77% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |