PCOLCE Rabbit Polyclonal Antibody
CAT#: TA337676
Rabbit Polyclonal Anti-PCOLCE Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
| Cited in 1 publication. |
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PCOLCE antibody: synthetic peptide directed towards the middle region of human PCOLCE. Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 48 kDa |
| Gene Name | procollagen C-endopeptidase enhancer |
| Database Link | |
| Background | PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity. |
| Synonyms | PCPE; PCPE-1; PCPE1 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86% |
| Reference Data | |
| Protein Families | Secreted Protein |
Citations (1)
| The use of this Antibodies has been cited in the following citations: |
|---|
|
Heparanase Promotes Tumor Growth and Liver Metastasis of Colorectal Cancer Cells by Activating the p38/MMP1 Axis
,Liu, X;Zhou, ZH;Li, W;Zhang, SK;Li, J;Zhou, MJ;Song, JW;,
Front Oncol
,PubMed ID 31001480
[PCOLCE]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
