Matrilin 3 (MATN3) Rabbit Polyclonal Antibody

CAT#: TA337662

Rabbit Polyclonal Anti-MATN3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of matrilin 3 (MATN3)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human matrilin 3 (MATN3), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human matrilin 3 (MATN3), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MATN3 antibody: synthetic peptide directed towards the middle region of human MATN3. Synthetic peptide located within the following region: IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 50 kDa
Gene Name matrilin 3
Background This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains two von Willebrand factor A domains; it is present in the cartilage extracellular matrix and has a role in the development and homeostasis of cartilage and bone. Mutations in this gene result in multiple epiphyseal dysplasia. [provided by RefSeq, Jul 2008]
Synonyms DIPOA; EDM5; HOA; OADIP; OS2
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome, Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...