NXPH4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NXPH4 antibody: synthetic peptide directed towards the N terminal of human NXPH4. Synthetic peptide located within the following region: MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	neurexophilin 4
Database Link	NP_009155 Entrez Gene 11247 Human UniProt ID O95158
Background	NXPH4 may be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.
Synonyms	NPH4
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rat: 92%; Mouse: 92%; Dog: 86%; Pig: 86%; Bovine: 86%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.