C20orf132 (MROH8) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MROH8 antibody: synthetic peptide directed towards the middle region of human MROH8. Synthetic peptide located within the following region: PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	maestro heat like repeat family member 8
Database Link	NP_998797 Entrez Gene 140699 Human UniProt ID Q9H579
Background	The function of this protein remains unknown.
Synonyms	C20orf131; C20orf132; dJ621N11.3; dJ621N11.4
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.