LRRC23 Rabbit Polyclonal Antibody
CAT#: TA337620
Rabbit Polyclonal Anti-LRRC23 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-LRRC23 antibody: synthetic peptide directed towards the N terminal of human LRRC23. Synthetic peptide located within the following region: LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 40 kDa |
| Gene Name | leucine rich repeat containing 23 |
| Database Link | |
| Background | LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown. |
| Synonyms | LRPB7 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Horse: 92%; Mouse: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
