XRRA1 Rabbit Polyclonal Antibody
CAT#: TA337601
Rabbit Polyclonal Anti-XRRA1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-XRRA1 antibody: synthetic peptide directed towards the N terminal of human XRRA1. Synthetic peptide located within the following region: MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 90 kDa |
Gene Name | X-ray radiation resistance associated 1 |
Database Link | |
Background | XRRA1 may be involved in the response of cells to X-ray radiation. |
Synonyms | AI449753 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Bovine: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |